<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA1435 CA14466 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 20
2 AZT+D4T 29
3 3TC+D4T 12
4 3TC+AZT+D4T+IDV 28
5 DDC+RTV+SQV 29
6 AZT+DDI+NFV 28
7 ABC+EFV+RTV+SQV 22
8 3TC+ABC+EFV+NFV 26
9 ABC+EFV+NFV 15
10 ABC+APV+EFV+NFV 11
11 ABC+APV+EFV+NFV 4
12 ABC+APV+NFV 31

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70KR, L74V, M184V, T215F K219Q K101KE, Y181C, G190S   E6EK, V35K, V60I, K104KN, V118I, K122E, I135T, S162D, F214L, A272P, E297K  
>CA14466| codons 1-300
PISPIKTVPVKLKPGMDGPKVKQWPLTEEKIKALKEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKNSVTVLDVGDAYFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDIVI
CQYVDDLYVSSDLEIGQHRTKIEELRQHLLRWGLFTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTKEAE

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M L33F L10V, T12S, L19Q, M36L, N37S, K43Q, I62V, L63P, A71V  
>CA14573| codons 1-99
PQITLWQRPVVSIKIGGQQKEALLDTGADDTIFEELSLPGRWQPKIIGGIGGFIKVRQYD
QVPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005