<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5697 CA14462 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+3TC+NFV 13
2 3TC+D4T+NFV 30
3 3TC+ABC+SQV 45

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65KR, L74LV, M184V       V106I, S162C, K173R, Q174R, R211K, F214L, K263KN, A272P N265ND
>CA14462| codons 1-279
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSITVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRRRNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGNLDWASQIYPGIKVKQL

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N, L90M L10F, N88D K45KR, L63P, I64V, I93L  
>CA14569| codons 1-99
PQITLWQRPFVTIKIGGQLKEALLDTGADNTVLEEMNLPGRWKPRMIGGIGGFIKVRQYD
QIPVEICGHKAIGTVLVGPTPVNIIGRDLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009