<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt177 QPh0eVf3bj Serbia 2004 HIV1 G Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, G16R, K20I, E35Q, M36I, R41K, R57K, L63P, C67E, H69K, V82I, L89M I15N
>QPh0eVf3bj| codons 6-99
WQRPLVTVKNRGQLIEALLDTGADDTVLEQINLPGKWKPKMIGGIGGFIKVKQYDQIPIE
IEGKKAIGTVLVGPTPINIIGRNMLTQIGCTLNF

References
Author Title Citation
Vercauteren, J Transmission of drug-resistant HIV-1 is stabilizing in Europe. J Infect Dis, 2009