<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA799 CA1443 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 261
2 DDI 65
3 AZT+DDI 52
4 3TC+AZT 48
5 D4T+DDC+RTV 31
6 D4T+DDC+IDV 13
7 3TC+AZT+RTV+SQV 13
8 D4T+NFV+NVP 9
9 3TC+AZT+D4T+IDV 14

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y D67E Y181C A98G V35IM, E44D, S68G, K122E, I135T, D177E, V179I, G196E, E203K, Q207E, D250E, A272P, V276I  
>CA1443| codons 1-285
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTELEKDGKISKIGPENPYNTPV
FAIKKKEGTKWRKLVDFRELNKRTQDFWEVQLGIPHPGGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIII
CQYVDDLYVGSDLEIEQHRTKIKELREHLWRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYPGIKIKQLCKLLRG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M   L10I, I15V, K20M, E35D, M36I, R57K, L63P, A71V  
>CA1442| codons 1-99
PQITLWQRPIVTIKVGGQLMEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVKQYD
QIPIEICGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Zolopa, AR HIV-1 genotypic resistance patterns predict response to saquinavir/ritonavir in patients in whom previous protease inhibitor therapy failed. Ann Intern Med, 1999
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005