<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt365 hk3n5YopRJ Sweden 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13A, K14R, K20I, E35D, M36I, N37D, R41K, L63P, H69K, L89M  
>hk3n5YopRJ| codons 1-99
PQITLWQRPLVTARIGGQLIEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QIPIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        E28K, V35T, E36D, T39M, V60I, I135R, S162A, Q174N, D177E, T200A, Q207G, R211K  
>hk3n5YopRJ| codons 28-239
KEKIKALTDICMEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDF
WEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKDFRKYTAFTIPSRNNETPGIRYQYN
VLPQGWKGSPAIFQASMTKILEPFRKNNPEIVIYQYMDDLYVGSDLEIGQHRAKIEELRG
HLLKWGFTTPDKKHQKEPPFLWMGYELHPDKW

References
Author Title Citation
Vercauteren, J Transmission of drug-resistant HIV-1 is stabilizing in Europe. J Infect Dis, 2009