<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA796 CA1437 U.S. 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 104
2 AZT+DDI 266
3 3TC+D4T+SQV 39
4 D4T+DDC+NFV 17
5 3TC+AZT+IDV+NVP 17
6 3TC+AZT+IDV 10

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, T69D, K70R, M184V, T215F V75M, K219W K103N, Y181C   K20KR, V35T, V60I, I94IL, K122E, I135T, V179VI, H208Y, D218E, L228H, V245E, E248Q  
>CA1437| codons 1-258
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSDRWRKLMDFRELNKRTQDFWEVQLGLPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIII
CQYVDDLYVGSDLEIGQHRTKIEELRQYLLRWGFFTPEWKHQKEPPFHWMGYELHPDKWT
VQPIELPQKDSWTVNDIQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M F53FL, G73S L10I, N37D, D60E, L63P, V77I, I93L  
>CA1436| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEEMDLPGRWKPKIIGGIGGLIKVRQYE
QIPIEICGHKAISTVLIGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005