<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AHHC18 HolgHC19 Spain 1998 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, I15V, K20I, E35Q, M36I, R41K, R57K, I64M, C67E, H69K, V82I, I85M, L89M  
>HolgHC19| codons 1-99
PQITLWQRPLVTVRVGGQLIEALLDTGADDTVLEQINLPGKWKPKMIGGIGGFIKVKQYD
QILMEIEGKKAIGTVLVGPTPINIMGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
  K219Q     V35K, V60I, D121Y, K122E, D177E, I178M, T200I, Q207G, R211K P217A, D218R
>HolgHC18| codons 25-220
PLTEEKIKALKEICTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRT
QDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLYEDFRKYTAFTIPSINNETPGIRY
QYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEMVIYQYMDDLYVGSDLEIGQHRIKIEE
LRGHLLKWGFTTARQK

References
Author Title Citation
Holguin, A Recombinant human immunodeficiency viruses type 1 circulating in Spain. ARHR, 2000