<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
AHHC17 HolgHC17 Spain 1999 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10I, E35D, M36I, R41K, L63A, C67D, H69K, L89M  
>HolgHC17| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QIAIEIDGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35R, V60I, K122E, D123N, T131P, I142T, T165I, K173S, Q174K, D177E, T200A, Q207A, E224D L149R
>HolgHC17| codons 25-224
PLTEEKIKALREICTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRT
QDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDENFRKYTAFPIPSINNETPGTRY
QYNVRPQGWKGSPAIFQSSMIKILEPFRSKNPEIVIYQYMDDLYVGSDLEIGQHRAKIEE
LRAHLLRWGFTTPDKKHQKD

References
Author Title Citation
Holguin, A Recombinant human immunodeficiency viruses type 1 circulating in Spain. ARHR, 2000
Holguin, A Impact of frequent natural polymorphisms at the protease gene on the in vitro susceptibility to protease inhibitors in HIV-1 non-B subtypes. J Clin Virol, 2004