<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
95cm-mp257 95cmmp257 Cameroon 1995 HIV1 F PBMC None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I15V, K20R, E35D, M36I, R41K, I62V, L63S, H69Q, L89M  
>95cmmp257| codons 1-99
PQITLWQRPVVTIKVGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVSIEICGQKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        V35T, K104R, D123E, T165I, Q174E, D177E, T200A, Q207E, P243A, V245Q, E248D, D250S, A272P, K275R, Q278H, E291D, I293V, E297A, Q334H, G335D, F346H, M357R, R358K, G359S, A371V, I375V, S379G, T386V, K390R, A400I, K431T, V435I, V458I, D471E, H483Q, L491S, Q509H, L517I, S519N, K527Q, K530R, A534S, A554T  
>95cmmp257| codons 1-560
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMIKILEPFRKENPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELREHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQAIQLPDKSSWTVNDIQKLVGKLNWASQIYPGIRVKHLCKLLRGTKALTDVVPLTAEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGHDQWTYQIYQEPHKNLKTGKYARRKSA
HTNDVKQLTEVVQKVATEGIVIWGKVPKFRLPIQKETWEIWWTEYWQATWIPEWEFVNTP
PLVKLWYQLETEPIIGAETFYVDGAANRETKLGKAGYITDRGRQKVVSLTETTNQKTELQ
AIQLALQDSGSEVNIVTDSQYALGIIQAHPDKSESEIVNQIIEQLIQKERVYLSWVPAHK
GIGGNEQVDKLVSTGIRKVL

Integrase Sequence
INIMajorDRMs INIMinorDRMs Polys UnusualMuts
  T97A L101I, T112I, T124A, T125V, K136Q, V201I, T218S, Y227F, L234V, S255N, D256E, V260I S283G
>95cmmp257| codons 1-288
FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKIILVAVHVASGYIEAEVIPAETGQEAAYFILKLAGRWPVKIIHTDNGSN
FTSAVVKAACWWAGIQQEFGIPYNPQSQGVVESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIIDIIATDIQTKELQKQISKIQNFRVYFRDSRDPVWKGPAK
LLWKGEGAVVIQDNNEIKVIPRRKAKIIRDYGKQMAGDDCVAGRQDED

References
Author Title Citation
Triques, K Near full length genome sequencing of divergent African HIV type 1 subtype F viruses leads to identification of a new HIV type 1 designated K. ARHR, 2000
Vergne, L Genetic diversity of protease and reverse transcriptase sequences in non-subtype-B human immunodeficiency virus type 1 strains: evidence of many minor drug resistance mutations in treatment-naive patients. J Clin Microbiol, 2000