Isolate Data
| Patient | Isolate | Region | Year | Species | Subtype | Source | Clone Method |
| CA795 | CA1434 | U.S. | 1997 | HIV1 | B | Plasma | None |
Treatment History
| Order | Regimen | Weeks |
| 1 | AZT+ DDI | NA |
| 2 | 3TC+ AZT | NA |
| 3 | 3TC+ D4T+ SQV | 40 |
| 4 | 3TC+ D4T+ NFV | 20 |
| 5 | IDV+ NVP+ 3TC+ D4T | 23 |
Protease Sequence
| PIMajorDRMs | PIMinorDRMs | Polys | UnusualMuts |
| G48V, I54V, V82A | L10I, I15V, M36I, I62V |
| >CA1434| codons 1-99 PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEEINLPGRWKPKMIVGIGGFVKVRQYD QVLIEICGHKAIGTVLVGPTPANIIGRNLLTQIGCTLNF |
References
| Author | Title | Citation |
| Lawrence, J | Clinical resistance patterns and responses to two sequential protease inhibitor regimens in saquinavir and reverse transcriptase inhibitor-experienced persons. | J Infect Dis, 1999 |
| Rhee, SY | HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. | J Infect Dis, 2005 |