<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt785 8460143385 Greece 2004 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14R, G16E, K20I, E35D, M36I, R41K, L63S, H69K, K70R, L89M V11VG
>8460143385| codons 4-99
TLWQRPLGTVRIEGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIS
IEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Vercauteren, J Transmission of drug-resistant HIV-1 is stabilizing in Europe. J Infect Dis, 2009