<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt822 8257904274 Spain 2003 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T39A, E40D, V60VI, K64R, S68G, D123N, I135V, S162A, K173T, Q174K, D177E, I178M, T200A, Q207E, R211K, P243T, V245Q  
>8257904274| codons 38-247
CADMEKEGKISKIGPENPYNTPIFAIRKKDGTKWRKLVDFRELNKRTQDFWEVQLGIPHP
AGLKKKKSVTVLDVGDAYFSVPLDKNFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSP
AIFQASMTKILEPFRTKNPEMVIYQYMDDLYVGSDLEIGQHRAKIEELREHLLKWGFTTP
DKKHQKEPPFLWMGYELHPDKWTVQTIQLP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, G16E, L19LI, K20I, M36I, R41K, H69K, K70R, I72V, L89M  
>8257904274| codons 4-99
TLWQRPLVTIRIEGQIIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIL
IEICGKRAVGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Vercauteren, J Transmission of drug-resistant HIV-1 is stabilizing in Europe. J Infect Dis, 2009