<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5758 CA14299 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI+NFV 28

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30N N88D N37X, L63P, V77I, I93L  
>CA14299| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADNTVLEEMXLPGRWKPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPVNIIGRDLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, K70R, T215Y K219E     K11KR, K20KR, E44D, V118VI, Q174QE, Q207E, L228H, S251SR, Q278QE K201K*, K220KN, N265NS
>CA14191| codons 1-280
PISPIETVPVRLKPGMDGPRVKQWPLTEEKIKALVEICTELEKDGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKENPDIVI
YQYMDDLYVGSDLEIGQHRT*IEELREHLLRWGFYTPDENHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDRWTVNDIQKLVGKLSWASQIYAGIKVKELC

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009