<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt986 7344543899 Portugal 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33I K14KR, N37S, R41K, I62V, L63P, A71T, V77I, I93L P39P*QS
>7344543899| codons 4-99
TLWQRPLVTIRIGGQLKEALLDTGADDTVIEEMSLSGKWKPKMIGGIGGFIKVRQYDQVP
IEICGHKTIGTVLIGPTPVNIIGRNLLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        L34I, E36X, V60I, V106VI, I135T, S162Y, R211K, V245I V35FL, I37IFLV
>7344543899| codons 34-247
ILXVCTEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLG
IPHPAGLKKKKSITVLDVGDAYFSVPLDKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGW
KGSPAIFQYSMTKILEPFRKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWG
FTTPDKKHQKEPPFLWMGYELHPDKWTVQPIILP

References
Author Title Citation
Vercauteren, J Transmission of drug-resistant HIV-1 is stabilizing in Europe. J Infect Dis, 2009