<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA4373 CA14248 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 3TC+D4T+IDV 30
2 ABC+ADV+EFV+NFV+SQV 20
3 ABC+DDI+IDV 14
4 ABC+DDI+IDV 29
5 ABC+APV+D4T+NVP 30

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, L90M G73T, L89LV I13IV, K55R, L63P, V77I  
>CA14248| codons 11-99
VTVKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIRVRQYDQIPIEICGHK
AITTVLIGPTPVNIIGRNVMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, Q151M, T215F F116Y, K219Q K103N, Y181C   M16ML, V35I, K43N, V60I, T69N, A98S, K122E, I135V, I167V, G196E, T200A, E203K, Q207D, H208Y, L228H, V245E, K263KN, T286TA, I293V S268CR, L279LF
>CA14139| codons 1-301
PISPIETVPVKLKPGLDGPKVKQWPLTEEKIKALIEICTELENEGKISKIGPENPYNTPI
FAIKKKNSNKWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKNKSVTVLDVGDAYYSVPL
DEDFRKYTAFTIPSVNNETPGIRYQYNVLPMGWKGSPAIFQSSMTKVLEPFRKQNPDIVI
CQYMDDLYVGSDLEIEQHRAKIKELRDYLLRWGFFTPDQKHQKEPPFHWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGNLNWACQIYAGIKVKQFCKLLRGAKALTEVVPLTEEAE
L

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005