<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5718 CA14246 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown 52
2 3TC+AZT+IDV 35
3 D4T+DDI+NFV 71

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, I54IV, V82A, L90M   L10LI, L19I, E35D, M36MI, M46X, L63P, I64V, I66IF, A71V  
>CA14246| codons 1-99
PQITLWQRPIVTIKIGGQIKEALLDTGADDTILEDINLPGRWKPKXIGGIGGFVKVRQYD
QIPVEFCGHKVIGTVLVGPTPANIIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
T69S_SS, T215Y A62V, D67E     K122E, I135IV, I142IV, D177E, L228H, A272AG, T286A, A288AG N265NS, E291EV
>CA14137| codons 1-296
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FVIKKKESSKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGFYTPDKKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLSWASQIYGGIKVKQLCKLLRGAKGLTVVIPLT

References
Author Title Citation
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005