<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5716 CA14242 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 61
2 AZT+DDC 35
3 3TC+AZT+IDV 100
4 D4T+DDC+NFV 110

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V32I, M46I, V82A, L90M   L10V, K14R, I15V, I64V, A71V, I93L  
>CA14242| codons 1-99
PQITLWQRPVVTIRVGGQLKEALLDTGADDTILEEMNLPGRWKPKIIGGIGGFIKVRQYD
QILVEICGHKVIGTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R K219Q     V35M, T39A, K102E, K122E, D123N, T200I, T286A, E297K  
>CA14133| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKEKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRIKIEELRQHLLRWGFTTPDQKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTKEAE

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001