<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt1292 5439504999 Greece 2005 HIV1 CRF02_AG Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q7HR, I13V, K14R, G16GE, K20I, M36I, R41K, L63A, C67Y, H69K, K70R, L89M W6*C
>5439504999| codons 4-99
TLCRRPLVTVRIEGQLIEALLDTGADDTVLEEINLPGKWKPKMIGGIGGFIKVRQYDQIA
IEIYGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Vercauteren, J Transmission of drug-resistant HIV-1 is stabilizing in Europe. J Infect Dis, 2009