<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5769 CA14207 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 343
2 3TC+D4T+IDV 181

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K70R, M184V       T69S, A98S, K122E, D123N, I142V, I178L, G196K, Q207H, V245T, K259E, L260V V261S
>CA14207| codons 1-261
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSSRWRKLVDFRELNKRTQDFWEVQLGIPHPSGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYVDDLYVGSDLEIKQHRTKIEELRHHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPITLPEKDSWTVNDIQEVS

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46MI, I54V, V82T   M36MI, R41K, K43R, L63P, A71V, I85IV, I93L  
>CA14315| codons 11-99
VTIKIGGQLKEALLDTGADDTVLEEINLPGKWRPKIIGGIGGFVKVRQYDQIPIEICGHK
VIGTVLVGPTPTNIVGRNLLTQLGCTLNF

References
Author Title Citation
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005