<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5743 CA14168 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 260
2 AZT+ 3TC 156
3 DDI+ NVP+ NFV 29
4 APV+ EFV+ RTV 25

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y   K101E, Y181C, G190A V108I, F227L K20R, T39S, K43Q, V118I, I135T, V189I, E203K, Q207E, R211K, K223E, D250DE, R284K, T286A, T290P L289P
>CA14168| codons 1-290
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICSELEQEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTILDVGDAYFSIPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYIASDLEIGQHRTKIKELREHLWKWGFYTPDKKHQEEPPLLWMGYELHPDKWT
VQPIVLPEKESWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKAPP

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, I54V, V82A, L90M L10F, V11I I13V, I15V, Q18H, K20I, N37D, D60E, I62V, L63P, A71V, I72M  
>CA14276| codons 1-99
PQITLWQRPFITVKVGGHLIEALLDTGADDTVLEEMDLPGRWKPKLIGGIGGFVKVRQYE
QVPIEICGHKVMGTVLVGPTPANIIGRNLMTQIGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005