<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5735 CA14158 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 30
2 D4T 52
3 AZT+3TC 13
4 AZT+3TC+IDV 69
5 D4T+NFV+NVP 65
6 D4T+NVP+RTV 71

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
    K101E, G190GA   T27S, E28K, K32E, V60I, T69N, R83K, Y181X, T200A, Q207D, L228R, V245E, T286A K281KE
>CA14158| codons 1-288
PISPIETVPVKLKPGMDGPKVKQWPLSKEKIEALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDSNKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
XQYMDDLYVASDLEIGQHRAKIEELRDHLLRWGFTTPDKKHQKEPPFRWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCELLRGAKA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   E35D, M36I, R41K, R57K, L63P, I72V, I93L  
>CA14265| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVKQYD
QIPIEICGHKAVGTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005
Rhee, SY Predictive value of HIV-1 genotypic resistance test interpretation algorithms. J Infect Dis, 2009