<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt1944 1594662750 Israel 2003 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, K14KQ, K20KR, E35D, M36I, R41K, L63P, H69K, L89M, I93L  
>1594662750| codons 4-99
TLWQRPLVTVQIGGQLREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIP
IEICGKKAIGTVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Vercauteren, J Transmission of drug-resistant HIV-1 is stabilizing in Europe. J Infect Dis, 2009
Grossman, Z Drug-resistant HIV infection among drug-naive patients in Israel. Clin Infect Dis, 2005