<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IP-13 IP13-M6 France 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI 24

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        I31V, R83K, K122E, E138EA, S162A, K173KN, Q174QE, V189I, I202V, L210F, P243X  
>IP13-M6| codons 1-250
PISPIETVPVKLKPGMDGPKVKQWPLTEEKVKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNATPGIRYQYNVLPQGWKGSPAIFQASMTKILEPFRNENPDIVI
YQYMDDLYIGSDLEIGQHRTKVEELRQHLFRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQXIVLPEKD

References
Author Title Citation
Pellegrin, I Emergence of zidovudine and multidrug-resistance mutations in the HIV-1 reverse transcriptase gene in therapy-naive patients receiving stavudine plus didanosine combination therapy. AIDS, 1999
Gonzales, MJ Extended spectrum of HIV-1 reverse transcriptase mutations in patients receiving multiple nucleoside analog inhibitors. AIDS, 2003
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005