<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
pt2185 108155411 Greece 2005 HIV1 D Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    Q7R, L10LP, T12A, I13V, I15V, K20I, E35D, M36I, R41K, L63P, I64L H69HD
>108155411| codons 7-99
RRPPVAVKVGGQLIEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYDQIPLEI
CGDKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K30Q, K32G, A33C, L34T, V35L, E36N, I37F, T39N, V60I, K104R, K122E, D123S, E169D, K173A, Q174K, D177E, I178V, T200A, Q207A, R211K, V245K  
>108155411| codons 30-247
QIGCTLNFCNEMEKEGKISKIGPENPYNTPIFAIKKKDSTKWRKLVDFRELNKRTQDFWE
VQLGIPHPAGLKKKRSVTVLDVGDAYFSVPLDESFRKYTAFTIPSINNETPGIRYQYNVL
PQGWKGSPAIFQSSMTKILDPFRAKNPEVVIYQYMDDLYVGSDLEIGQHRAKIEELRAHL
LKWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPIKLP

References
Author Title Citation
Vercauteren, J Transmission of drug-resistant HIV-1 is stabilizing in Europe. J Infect Dis, 2009