<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
IP-43 IP43-M10 France 1997 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 D4T+DDI 40

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        K32T, V35M, E36EG, T69S, D76X, D123E  
>IP43-M10| codons 31-133
ITALMGICTEMEKEGKISKIGPENPYNTPVFAIKKKDSSKWRKLVXFRELNKRTQDFWEV
QLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDKEFRKYTAFTIP

References
Author Title Citation
Pellegrin, I Emergence of zidovudine and multidrug-resistance mutations in the HIV-1 reverse transcriptase gene in therapy-naive patients receiving stavudine plus didanosine combination therapy. AIDS, 1999
Rhee, SY HIV-1 Protease and Reverse Transcriptase Mutations: Correlations with Antiretroviral Therapy in Subtype B Isolates and Implications for Drug-Resistance Surveillance. J Infect Dis, 2005