<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
P1209 P1209.1 Spain 2006 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 None NA

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V       V60I, S68G, K122E, I135T, K173KE, Q174R, I178L, R211K P25PS, E29EQ, Q85QP
>P1209.1| codons 1-214
PISPIETVPVKLKPGMDGPKVKQWSLTEQKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKDGTKWRKLVDFRELNKRTPDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRERNPDLVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLKWGF

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
L90M   L10I, I15V, E35D, M36I, I62V, L63T, I64V, C67S, I93L  
>P1209.1| codons 1-99
PQITLWQRPIVTIKVGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFIKVRQYD
QVTVEISGHKAIGTVLVGPTPVNIIGRNLMTQLGCTLNF

References
Author Title Citation
Cuevas, MT HIV-1 transmission cluster with T215D revertant mutation among newly diagnosed patients from the Basque Country, Spain. JAIDS, 2009