<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
P1074 P1074.1 Spain 2005 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 None NA

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, G16E, M36I, N37NS, L63T, H69K, V82I, L89M, I93L  
>P1074.1| codons 1-99
PQITLWQRPLVTIKVEGQLKEALLDTGADDTVLEEISLPGRWKPKMIGGIGGFIKVRQYD
QITIEICGKKAIGTVLVGPTPINIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        T27S, V35T, T39D, S48T, K122E, K173A, Q174K, D177E, G196K, T200A, Q207E, R211K  
>P1074.1| codons 1-214
PISPIETVPVKLKPGMDGPKVKQWPLSEEKIKALTEICDEMEKEGKITKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIKQHRAKIEELREHLLKWGF

References
Author Title Citation
Cuevas, MT HIV-1 transmission cluster with T215D revertant mutation among newly diagnosed patients from the Basque Country, Spain. JAIDS, 2009