<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
89 08p89-2 Germany 2008 HIV1 A Plasma None

Treatment History
Order Regimen Weeks
1 FTC+NVP+TDF 28

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184I   K101KE, G190S   V35I, E36D, T39K, K122E, D123S, K173A, Q174K, D177E, V179I, T200I, Q207A, R211S, V245M, E248D, A272P, T286A, E291D, V292I, I293V, I326V  
>08p89-2| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIDICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLEKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIII
YQYIDDLYVSSDLEIGQHRIKIEELRAHLLSWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIMLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLVAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14R, G16E, E35D, M36I, R41K, I62V, H69K, V77I, L89M  
>08p89-2| codons 1-99
PQITLWQRPLVTIRIEGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QVLIEICGKKAIGTVLIGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008