<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
86 07p86-1 Germany 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 30
2 DDI 39
3 D4T+DDI 13
4 D4T+DDI+SQV 4
5 D4T+DDI+IDV 128
6 D4T+DDI+IDV+RTV 1
7 D4T+DDI+IDV 235
8 3TC+NVP+TDF 96
9 FTC+NVP+TDF 113

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
K65R, M184MV   Y181C   K122E, D123N, I132IL, I135T, I142V, I202V, Q207R, A272P, K277R, Q334N G152E
>07p86-1| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKRKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DENFRKYTAFTLPSTNNETPGVRYQYNVLPQEWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYVDDLYVGSDLEIGQHRTKVEELRRHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGNG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12P, N37S, I64V, C67W, V77I, I93L  
>07p86-1| codons 1-99
PQITLWQRPLVPIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILVEIWGHKAIGTVLIGPTPVNIIGRNLLTQLGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008