<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
83 08p83-3 Thailand 2008 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+NVP 87

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74I, Y115F, M184V   Y181I   E6D, K11T, K32R, V35T, T39K, K43E, T69N, K102R, K122E, D123S, F171Y, K173R, Q174K, D177E, I178M, Q207A, R211S, H221Y, V245E, K281R, E291D, I293V, K311KR, E312N P150A
>08p83-3| codons 1-332
PISPIDTVPVTLKPGMDGPKVKQWPLTEEKIRALTEICKEMEEEGKISKIGPENPYNTPV
FAIKKKDSNKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAFFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLAQGWKGSPAIFQSSMTKILEPYRRKNPEMVI
IQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKYQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGTKALTDVVPLTEEAE
LELAENREILRNPVHGVYYDPSKDLIAEIQKQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, E35D, M36I, N37D, R41K, L63S, H69K, K70R, L89M  
>08p83-3| codons 1-99
PQITLWQRPVVTVKIGGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008