<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
83 07p83-2 Thailand 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+ABC+NVP 46

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    L10V, I13V, G16E, E35D, M36I, N37D, R41K, L63S, H69K, K70R, L89M  
>07p83-2| codons 1-99
PQITLWQRPVVTVKIEGQLKEALLDTGADDTVLEDIDLPGKWKPKMIGGIGGFIKVRQYD
QISIEICGKRAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
L74I, Y115F, M184V   Y181I   E6G, K11T, K32R, V35T, T39K, K43E, T69N, K102R, K122E, D123S, F171Y, K173R, Q174K, D177E, I178M, Q207A, R211S, H221Y, K238R, V245E, K281R, E291D, I293V, E312S, I326V, I329V C38CR
>07p83-2| codons 1-334
PISPIGTVPVTLKPGMDGPKVKQWPLTEEKIRALTEIRKEMEEEGKISKIGPENPYNTPV
FAIKKKDSNKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKRKKSVTVLDVGDAFFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPYRRKNPEMVI
IQYVDDLYVGSDLEIGQHRTKIEELRAHLLSWGFTTPDKKYQKEPPFLWMGYELHPDRWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCRLLRGTKALTDVVPLTEEAE
LELAENREILKSPVHGVYYDPSKDLVAEVQKQGQ

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008