<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
82 07p82-2 Thailand 2007 HIV1 CRF01_AE Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+LPV 92
2 3TC+ABC+AZT 104

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M184V, T215F       E6D, V8I, K11T, V35T, T39K, K122E, D123S, I178M, T200A, Q207A, R211S, V245E, E291A, E312T, I326V, I329V  
>07p82-2| codons 1-334
PISPIDTIPVTLKPGMDGPKVKQWPLTEEKIKALTEICKEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDMVI
YQYVDDLYVGSDLEIGQHRAKIEELRAHLLSWGFFTPDKKHQKEPPFLWMGYELHPDKWT
VQPIELPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTAVIPLTEEAE
LELAENREILKTPVHGVYYDPSKDLVAEVQKQGQ

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I13V, I15V, E35D, M36I, R41K, H69K, L89M  
>07p82-2| codons 1-99
PQITLWQRPLVTVKVGGQLKEALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYD
QILIEICGKKAIGTVLVGPTPVNIIGRNMLTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008