<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
81 02p81-1 Germany 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDI 78
2 AZT+DDI+RTV 70
3 AZT+D4T+SQV 30
4 None 165
5 AZT+DDI+RTV 25

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A, L90M   L10I, T12P, K14R, K43R, L63P, V77I, I93L  
>02p81-1| codons 1-99
PQITLWQRPIVPIRIGGQLKEALLDTGADDTVLEEMNLPGRWRPKMIGGIGGFIKVRQYD
QIPIEICGHKAIGTVLIGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
        R83K, K122E, I135V, E138A, S162T, D177E, G196E, T200I, I202V, R211G, V245I, D250E, A272P, K277R, A288S, E297K, S322T, Q334D  
>02p81-1| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKKTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSVNNATPGIRYQYNVLPQGWKGSPAIFQTSMTKILEPFRKQNPEIVI
YQYMDDLYVGSDLEIEQHRIKVEELRQHLLGWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIILPEKESWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKSLTEVIPLTKEAE
LELAENREILKEPVHGVYYDPTKDLIAEIQKQGDG

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008