<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
78 02p78-1 Germany 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 163
2 DDI 36
3 DDI+SQV 5
4 3TC+DDI+SQV 9
5 3TC+D4T+SQV 17
6 3TC+D4T+RTV 24
7 D4T+RTV 22
8 D4T+RTV+SQV 59
9 ABC+DDI+EFV 175

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
V82A L33F L10V, I13V, K14R, G16A, M36I, N37D, R57K, L63E, I64IV, E65D, V77VI  
>02p78-1| codons 1-99
PQITLWQRPVVTVRIAGQLKEALLDTGADDTVFEEIDLPGRWKPKMIGGIGGFIKVKQYD
QIEVDICGHKAIGTVLIGPTPANIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67DN, L74LV, Y115YF, M184MV, L210W K219KR L100LI, K103N, V106VA F227FL V35M, T39A, K43E, A98S, V118I, K122E, I135T, G196E, T200A, I202V, R211RK, H221HY, A272P, K275KR, I293V, Q330P, Q334E E328EQ
>02p78-1| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICAELEEEGKISKIGPENPYNTPV
FAIKKKNSTKWRKVVDFRELNKRTQDFWEVQLGIPHPSGIKKNKSATVLDVGDAFFSIPL
DEDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIEQHRAKVEELRQHLWKWGFTTPDRKYQKEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIRVKQLCKLLRGTKALTEVVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAQIPKQGEG

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008