<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
77 02p77-1 Germany 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 22
2 3TC+AZT 130
3 3TC+D4T+SQV 9
4 3TC+D4T+IDV 31
5 D4T+IDV 8
6 DDI+NFV 9
7 DDI+NFV+SQV 13
8 DDI+NVP+RTV+SQV 43
9 DDI+RTV+SQV 2
10 3TC+ABC+AZT 2
11 3TC+ABC+AZT+EFV 92
12 APV+DDI+LPV+NVP 115

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
D30DN, M46MI, I84V, L90M L33LF L5LF, L10LI, L24LF, R41K, F53Y, I62IV, L63P, A71AV, I72IK, V77I, I93L  
>02p77-1| codons 1-99
PQITFWQRPIVTIKIGGQLKEALFDTGADNTVFEEMNLPGKWKPKIIGGIGGYIKVRQYD
QVPIEICGHKVKGTVLIGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74V, M184V, L210W, T215Y V75VM K103N, G190GA   K43E, E44D, V118VI, D123E, I135IV, D177E, V189VI, T200A, Q207DH, H208F, R211K, E224EK, D237DE, Q278E, T286A, E297R  
>02p77-1| codons 1-335
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKVMDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSVNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPEIVI
YQYVDDLYIASDLEIGQHRAKIEELRHFLWKWGFYTPDKKHQKKPPFLWMGYELHPEKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKELCKLLRGAKALTEVIPLTREAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008