<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
74 08p74-5 Germany 2008 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 76
2 AZT+DDI 2
3 AZT 65
4 AZT+DDC 50
5 AZT 39
6 3TC+AZT 8
7 3TC+AZT+SQV 88
8 3TC+D4T+NFV 173
9 3TC+ABC+EFV 52
10 None 115
11 3TC+ABC+LPV+TDF 242

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
G48M, I50V, I54V, V82A, L90M K43T, F53L, G73S L10I, I15V, K20R, E35D, M36I, N37D, R57K, Q61QR, I62V, L63P, I93L A71M
>08p74-5| codons 1-99
PQITLWQRPIVTIKVGGQLREALLDTGADDTVLEDIDLPGRWTPKMIMGVGGLVKVKQYD
RVPIEICGHKMISTVLVGPTPANIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, V75M, M184V, L210W, T215Y       P4PT, E6DN, K20R, A33AG, V35ILPT, T39TA, K43N, E44ED, V60VI, K64KR, V118VI, D121HY, K122E, I178L, T200TA, E203Q, Q207D, H208FY, R211K, T286A, V292VI, I293V, E297K, V317A, I329V, G333E H221HCRY
>08p74-5| codons 1-335
PISTINTVPVKLKPGMDGPRVKQWPLTEEKIKGLTEICAELENDGKISKIGPENPYNTPI
FAIRKKNSTKWRKLMDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYVDDLYVGSDLEIGQHRAKIQELRDYLWKWGFYTPDKKYQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEIVPLTKEAE
LELAENREILKEPVHGAYYDPSKDLIAEVQKQEQG

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008