<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
74 02p74-3 Germany 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 76
2 AZT+DDI 2
3 AZT 65
4 AZT+DDC 50
5 AZT 39
6 3TC+AZT 8
7 3TC+AZT+SQV 88
8 3TC+D4T+NFV 173
9 3TC+ABC+EFV 52

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, L90M G73S L10I, I15V, K20T, E35D, M36I, R57K, L63P, A71I, T74S, I93L  
>02p74-3| codons 1-99
PQITLWQRPIVTIKVGGQLTEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVKQYD
QIPIEICGHKIISSVLVGPTPVNIIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, M184V   K103N, Y181C   E6D, K20R, V35T, K43N, V60I, K102R, D121Y, K122E, I178L, Q207E  
>02p74-3| codons 1-207
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTELENEGKISKIGPENPYNTPI
FAIKKKDSTKWRKIVDFRELNKRTQDFWEVQLGIPHPAGLKRNKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
CQYVDDLYVGSDLEIGQHRTKIEELRE

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008