<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
74 00p74-1 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 76
2 AZT+DDI 2
3 AZT 65
4 AZT+DDC 50
5 AZT 39
6 3TC+AZT 8
7 3TC+AZT+SQV 88
8 3TC+D4T+NFV 143

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54IV, I84IV, L90M L33LI, K43KT, G73S L10IV, I15V, K20RT, E35D, M36I, R57RK, I62IV, L63P, A71V, T74TS, I93L  
>00p74-1| codons 1-99
PQITLWQRPVVTIKVGGQLTEALLDTGADDTVIEDINLPGRWTPKMIGGIGGFVKVKQYD
QVPIEICGHKVISSVLVGPTPVNVIGRNLMTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, M184V, L210W, T215Y       E6D, K20R, V35T, K43N, K49R, V60I, D121Y, K122E, I178L, Q207E, R211K, R284K, T286A, I293V, E297K  
>00p74-1| codons 1-324
PISPIDTVPVKLKPGMDGPRVKQWPLTEEKIKALTEICTELENEGKISRIGPENPYNTPI
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
YEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVI
YQYVDDLYVGSDLEIGQHRTKIEELREHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLKGAKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008