<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
71 09p71-3 Congo-Brazzaville 2009 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+LPV 12
2 3TC+AZT 3
3 3TC+ABC+AZT+TDF 27
4 LPV+NVP+TDF 52
5 LPV+TDF 99
6 FTC+LPV+TDF 12

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A   I15V, Q18E, K20R, E35D, M36I, R41K, K45I, D60E, I62V, L63V, H69K, L89M, I93L  
>09p71-3| codons 1-99
PQITLWQRPLVTIKVGGELREALLDTGADDTVLEDINLPGKWKPIMIGGIGGFVKVRQYE
QVVIEICGKKAIGTVLVGPTPANIIGRNMLTQLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L       V35T, T39K, K122E, D123S, I142V, K173A, Q174K, D177E, T200A, R211K, E248N, A272P, K277R, T286A, E291D, V292I, I293V, I329L  
>09p71-3| codons 1-332
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICKELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYMDDLYVGSDLEIGQHRAKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPNKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTDIVPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQ

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008