<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
71 06p71-2 Congo-Brazzaville 2006 HIV1 C Plasma None

Treatment History
Order Regimen Weeks
1 3TC+AZT+LPV 12
2 3TC+AZT 3
3 3TC+ABC+AZT+TDF 22

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41ML, D67DN, M184V, T215F   K103KN   V35T, K122E, D123S, I142V, K173A, Q174K, D177E, T200A, R211K, D218DE, L228LR, E248D, A272P, T286A, E291D, V292I, I329L  
>06p71-2| codons 1-333
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTELEKEGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DESFRKYTAFTIPSINNETPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRAKNPEIVI
YQYVDDLYVGSDLEIGQHRAKIEELRQHLLKWGFFTPEKKHQKEPPFRWMGYELHPDKWT
VQPIVLPDKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGAKALTDIIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAELQKQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    I15V, Q18E, K20R, E35D, M36I, R41K, D60E, Q61E, I62V, L63V, H69K, T74A, L89M, I93L  
>06p71-2| codons 1-99
PQITLWQRPLVTIKVGGELREALLDTGADDTVLEDINLPGKWKPKMIGGIGGFIKVRQYE
EVVIEICGKKAIGAVLVGPTPVNIIGRNMLTQLGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008