<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA3920 CA13979 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 72
2 AZT+DDC 134
3 3TC+D4T 36
4 3TC+AZT+IDV 16
5 3TC+AZT+NFV 46
6 NVP+3TC+D4T+NFV 62
7 ABC+DDI+RTV+SQV 34

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
  L33F N37S, P39S, I62V, I64V, V77I  
>CA13979| codons 1-99
PQITLWQRPLVTIKIGGQLKEALLDTGADDTVFEEMSLSGRWKPKMIGGIGGFIKVRQYD
QVLVEICGHKAIGTVLIGPTPVNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184V, T215F K219Q     V35M, K104N, K166R, G196E, H208Y, R211K, D218E, V245T, E248D Q197T
>CA37719| codons 1-249
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALMEICTEMEKEGKISKIGPENPYNTPV
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKNSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTRILEPFRKQNPDIVI
YQYVDDLYVGSDLEIETHRTKIEELRQYLLKWGFFTPEQKHQKEPPFLWMGYELHPDKWT
VQPITLPDK

References
Author Title Citation
Wu, TD Mutation patterns and structural correlates in human immunodeficiency virus type 1 protease following different protease inhibitor treatments. J Virol, 2003
Gonzales, MJ Protease and reverse transcriptase mutation patterns in HIV-1 isolates from heavily treated persons: Comparison of isolates from northern California with isolates from other regions. ARHR, 2003
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005