<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
70 00p70-1 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 313
2 3TC+AZT+D4T 22
3 3TC+D4T+NFV 30
4 D4T+DDI+NVP 52
5 D4T+DDI+NFV 109

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
I54V, V82A, L90M L10F, K43T L19LI, D60DE, L63P, A71V, I72V, V77I, Q92QK, I93L  
>00p70-1| codons 1-99
PQITLWQRPFVTIKIGGQIKEALLDTGADDTVLEEMNLPGRWTPKMIGGIGGFVKVRQYE
QIPIEICGHKVVGTVLIGPTPANIIGRNLMTKLGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74V, L210W, T215Y   K101EQ, Y181C, G190A   V35I, K43Q, E44D, K49R, K122E, S162D, E169D, D177E, V179I, G196E, Q207N, R211K, A272P, K277R, T286A, E297K  
>00p70-1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALIEICTELEQDGKISRIGPENPYNTPV
FAIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLQKKKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILDPFRKQNPEIII
CQYMDDLYVASDLEIEQHRTKIEELRNHLWKWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGAKALTEVIPLTKEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008