<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
CA5632 CA13978 U.S. 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 Unknown NA
2 AZT+NFV+NVP 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I84V, L90M G73S I15V, K20I, R57K, L63P, H69K, A71V, I72X, V77VI  
>CA13978| codons 1-99
PQITLWQRPLVTIKVGGQLIEALLDTGADDTVLEEMNLPGRWKPKIIGGIGGFIKVKQYD
QIPIEICGKKVXSTVLIGPTPVNVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L210LW, T215Y   V106A F227FL K43KQ, E44ED, K104KR, L109LV, K122E, H208HY, R211RK, D218DE, A272P, K277R, Q278H, E297K I293GV, E300EV
>CA13913| codons 1-300
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEQDGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSATVVDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQYLWKWGFYTPEKKHQKEPPLLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRHLCKLLRGTKALTEVGPLTKEAV

References
Author Title Citation
Gonzales, MJ HIV-1 reverse transcriptase and protease subtypes: Classification, amino acid mutation patterns, and prevalence in a northern California clinic-based population. J Infect Dis, 2001
Rhee, SY HIV-1 protease and reverse transcriptase mutations: Correlations with antiretroviral therapy in subtype B isolates and implications for drug-resistance surveillance. J Infect Dis, 2005