<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
67 00p67-1 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 DDC 123
2 None 4
3 3TC 4
4 3TC+IDV 59
5 3TC+AZT+NFV 53
6 3TC+D4T+EFV 37
7 3TC+DDI+EFV 61

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, K70R, M184LV K219Q K103N P225H, K238KN K20R, V60I, K101KQ, I135T, S162Y, Q174QH, F214L, L228H, K277R, Q278H, T286A, D320DY  
>00p67-1| codons 1-324
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPI
FAIKKKNSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLQKNKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQYSMTKILEPFRKHNPDIVI
YQYVDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDQKHQKEHPFHWMGYELHPDNWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRHLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYYYPSKD

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    K14KR, I15V, I72V  
>00p67-1| codons 1-99
PQITLWQRPLVTIRVGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAVGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008