<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
65 02p65-5 Germany 2002 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 18
2 AZT+DDI 7
3 None 3
4 AZT+DDI 4
5 None 21
6 3TC 12
7 3TC+AZT 6
8 3TC+AZT+RTV 58
9 3TC+AZT+RTV+SQV 44
10 D4T+DDI+RTV+SQV 75
11 D4T+DDI+NFV 28
12 AZT+DDI+IDV+RTV 10
13 3TC+ABC+D4T+EFV 22
14 ABC+AZT+DDI+LPV 15
15 ABC+DDI+LPV 1
16 ABC+D4T+DDI+LPV 17
17 ABC+APV+DDI+EFV+RTV 43
18 3TC+ABC+APV+DDI+LPV+RTV+TDF 11
19 None 3

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, L74I, M184V, L210W, T215Y V75T, K219E K103N A98G, V108I K20R, V35I, K43Q, V118I, K122V, D123N, I135L, S162D, I178L, I202V, D218E, F227FY, A272P, Q334K  
>02p65-5| codons 1-334
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALIEICTELEQEGKISKIGPENPYNTPV
FAIKKKNSTKWRKITDFRELNKRTQDFWEVQLGIPHPGGLKKNKSVTILDVGDAYFSIPL
DVNFRKYTAFTIPSLNNETPGIRYQYNVLPQGWKGSPAIFQDSMTKILEPFRKQNPDLVI
YQYVDDLYVGSDLEIGQHRTKVEELRQHLWRWGFYTPEEKHQKEPPYLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGK

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54T, V82A, L90M L10F, L33F, G73T, L89V G16A, N37D, R41K, I62V, L63P, C67Y, A71V, I72IT, V77I  
>02p65-5| codons 1-99
PQITLWQRPFVTIKIAGQLKEALLDTGADDTVFEEMDLPGKWKPKIIGGIGGFTKVRQYD
QVPIEIYGHKVTTTVLIGPTPANIIGRNVMTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008