<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
65 00p65-1 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 18
2 AZT+DDI 7
3 None 3
4 AZT+DDI 4
5 None 21
6 3TC 12
7 3TC+AZT 6
8 3TC+AZT+RTV 58
9 3TC+AZT+RTV+SQV 44
10 D4T+DDI+RTV+SQV 75
11 D4T+DDI+NFV 28
12 AZT+DDI+IDV+RTV 1

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54GV, V82A, I84V, L90M G73A L10I, V11A, Q18QR, N37D, R41K, L63P, V75VA  
>00p65-1| codons 1-99
PQITLWQRPIATIKIGGRLKEALLDTGADDTVLEEMDLPGKWKPKIIGGIGGFVKVRQYD
QIPIEICGHKAIATALVGPTPANVIGRNLMTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, K70R, V75VAIT, T215Y K219Q     V8G, V21A, K43Q, V60VI, V118I, K122V, D123N, I178L, I202V, D218E, A272P  
>00p65-1| codons 2-324
ISPIETGPVKLKPGMDGPKAKQWPLTEEKIKALVEICTELEQEGKISKIGPENPYNTPIF
AIKKKDSTRWRKLTDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPLD
VNFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDLVIY
QYMDDLYVGSDLEIGQHRTKVEELRQHLLRWGFYTPEQKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVKQLCKLLRGTKALTEVIPLTEEAEL
ELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008