<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
63 03p63-1 Germany 2003 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 87
2 3TC+D4T 15
3 3TC+D4T+SQV 9
4 3TC+D4T+IDV 168
5 3TC+D4T+EFV+IDV 1
6 3TC+D4T+EFV 17
7 3TC+ABC+EFV 152

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, L74I, V75T, M184I, L210W, T215Y K219E G190S   K20R, I135M, I142T, Q207QK, R211N, F214FL, V245K, T286A, I293V, E297K  
>03p63-1| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKITDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPL
DKDFRKYTAFTIPSMNNETPGTRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYIDDLYVSSDLEIGQHRTKIEELRKHLWNWGLYTPDEKHQKEPPFLWMGYELHPDKWT
VQPIKLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVVPLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
    T12R, L19I, R41K, I62V  
>03p63-1| codons 1-99
PQITLWQRPLVRIKIGGQIKEALLDTGADDTVLEEMNLPGKWKPKMIGGIGGFIKVRQYD
QVLIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008