<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
62 00p62-1 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT+DDC 139
2 3TC+AZT 22
3 3TC+AZT+IDV 60
4 3TC+D4T+IDV 1
5 3TC+D4T+SQV 111

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46L, G48V, V82T   L10I, I13V, N37S, R57K, L63P, H69Y, A71V, I72L  
>00p62-1| codons 1-99
PQITLWQRPIVTVKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKLIVGIGGFIKVKQYD
QIPIEICGYKVLGTVLVGPTPTNIIGRNLLTQIGCTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, L210W, T215Y       V60I, V118I, D123E, I135IMT, T200R, R211N, T286A, P321L Y319AT, D320K, K323I
>00p62-1| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTELEKEGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSTNNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYVDDLYVGSDLEIGQHRRKIEELRQHLWNWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGAKALTEVIPLTEEAE
LELAENREILKEPVHGVYTKLSID

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008