<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
61 07p61-7 Germany 2007 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 AZT+DDC 109
3 3TC+AZT 29
4 3TC+AZT+SQV 54
5 3TC+AZT+IDV 16
6 D4T+NFV 35
7 3TC+AZT+DLV 9
8 3TC+AZT+DLV 8
9 3TC+AZT+RTV 68
10 AZT+DDI+RTV+SQV 50
11 3TC+D4T+LPV 383

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
M41L, D67N, M184V, T215Y K219R K103NS   K20KR, T27S, T39A, K43E, E44D, V60I, V118I, K122KR, D123E, E138Q, I142V, D177E, I178L, V179I, Q207E, L210S, L228H, I293V, P294Q, E297K  
>07p61-7| codons 1-335
PISPIETVPVKLKPGMDGPRVKQWPLSEEKIKALVEICAELEEDGKISKIGPENPYNTPI
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKSKSVTVLDVGDAYFSIPL
DREFRKYTAFTIPSINNQTPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPELII
YQYVDDLYVGSDLEIGQHRTKIEELREHLSRWGFYTPDRKHQKEPPFHWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVQLTKEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQG

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V, L90M   L10I, T12P, K20R, E35D, M36I, N37T, R41K, L63P, I66V, A71V, Q92R, I93L, C95F  
>07p61-7| codons 1-99
PQITLWQRPIVPIKIGGQLREALLDTGADDTVLEDITLPGKWKPKIIGGIGGFVKVRQYD
QIPIEVCGHKVIGTVLVGPTPTNVIGRNLMTRLGFTLNF

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008