<!--#if expr="$title" --> <!--#echo var="title" --> <!--#else --> HIV Drug Resistance Database <!--#endif -->
Stanford University HIV Drug Resistance Database - A curated public database designed to represent, store, and analyze the divergent forms of data underlying HIV drug resistance.

Isolate Data

Patient Isolate Region Year Species Subtype Source Clone Method
61 00p61-2 Germany 2000 HIV1 B Plasma None

Treatment History
Order Regimen Weeks
1 AZT 56
2 AZT+DDC 109
3 3TC+AZT 29
4 3TC+AZT+SQV 54
5 3TC+AZT+IDV 16
6 D4T+NFV 35
7 3TC+AZT+DLV 9
8 3TC+AZT+DLV 8
9 3TC+AZT+RTV 68
10 AZT+DDI+RTV+SQV 44

Protease Sequence
PIMajorDRMs PIMinorDRMs Polys UnusualMuts
M46I, I54V, V82T, I84V, L90M   L10I, E35D, N37T, R41K, L63P, I66V, A71V, I93L, C95F  
>00p61-2| codons 1-99
PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDMTLPGKWKPKIIGGIGGFVKVRQYD
QIPIEVCGHKVIGTVLVGPTPTNVIGRNLMTQLGFTLNF

RT Sequence
NRTIMajorDRMs NRTIMinorDRMs NNRTIMajorDRMs NNRTIMinorDRMs Polys UnusualMuts
D67N, T215Y   K103N   T39A, K43E, E44D, V118I, D123E, E138Q, I142V, R172K, D177E, I178L, Q207E, L210S, I293V, P294Q, E297K  
>00p61-2| codons 1-324
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICAEMEEDGKISKIGPENPYNTPV
FAIKKKNSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSIPL
DKEFRKYTAFTIPSINNQTPGVRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPELVI
YQYMDDLYVGSDLEIGQHRTKIEELREHLSRWGFYTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVKQLCKLLRGTKALTEVVQLTKEAE
LELAENREILKEPVHGVYYDPSKD

References
Author Title Citation
Rosen-Zvi, M Selecting anti-HIV therapies based on a variety of genomic and clinical factors. Bioinformatics, 2008